GitPlanet

Cheap and reliable Node.js hosting starts at $3/month, and $1/month static HTML hosting

Created with love in Canada, visit hostnodejs.com today

Feel like to post an Ad? Learn Details
All Projects → SemanticMediaWiki → Mermaid

SemanticMediaWiki / Mermaid

Licence: other
Provides a parser function to generate diagrams and flowcharts with the help of the mermaid script language

Programming Languages

PHP
23972 projects - #3 most used programming language
javascript
184084 projects - #8 most used programming language

Labels

chartchartsdiagrammediawikigraphsdiagramsflowchartgantt-chartmermaidsequence-diagramflow-chartganttchart

Projects that are alternatives of or similar to Mermaid

fusioncharts-dist
FusionCharts JavaScript Charting library. Over 95+ charts and 1,400+ maps to choose from, with integrations available for all popular JavaScript frameworks & back-end programming languages.
Stars: ✭ 65 (+140.74%)
Mutual labels:  charts, graphs, gantt-chart
Squid
A Ruby library to plot charts in PDF files
Stars: ✭ 205 (+659.26%)
Mutual labels:  chart, charts, graphs
Vzl
💠 DOT Language Live Editor (GraphViz)
Stars: ✭ 83 (+207.41%)
Mutual labels:  charts, diagram, flowchart
Grafana Flowcharting
Flowcharting, plugin for Grafana to create complexe visio's draws style like technical architectures, floorplan, diagrams, hierarchical schema based on draw.io
Stars: ✭ 463 (+1614.81%)
Mutual labels:  diagram, diagrams, flowchart
Uplot
📈 A small, fast chart for time series, lines, areas, ohlc & bars
Stars: ✭ 6,808 (+25114.81%)
Mutual labels:  chart, charts, graphs
Diagram Maker
A library to display an interactive editor for any graph-like data.
Stars: ✭ 2,086 (+7625.93%)
Mutual labels:  diagram, diagrams, flowchart
awesome-canvas
Canvas资源库大全中文版。An awesome Canvas packages and resources.
Stars: ✭ 288 (+966.67%)
Mutual labels:  chart, charts, flowchart
React Flow Chart
A flexible, stateless, declarative flow chart library for react.
Stars: ✭ 1,051 (+3792.59%)
Mutual labels:  diagram, diagrams, flowchart
Gojs
JavaScript diagramming library for interactive flowcharts, org charts, design tools, planning tools, visual languages.
Stars: ✭ 5,739 (+21155.56%)
Mutual labels:  chart, diagram, flowchart
Vue Chartjs
📊 Vue.js wrapper for Chart.js
Stars: ✭ 4,554 (+16766.67%)
Mutual labels:  chart, diagram, diagrams
SwiftCharts
Easy to use and highly customizable charts library for iOS
Stars: ✭ 2,405 (+8807.41%)
Mutual labels:  chart, charts, graphs
X6
🚀 JavaScript diagramming library that uses SVG and HTML for rendering.
Stars: ✭ 2,686 (+9848.15%)
Mutual labels:  chart, diagram, flowchart
React Jsx Highcharts
Highcharts built with proper React components
Stars: ✭ 336 (+1144.44%)
Mutual labels:  chart, charts, graphs
Flowy Vue
Vue Flowy makes creating flowchart or hierarchy chart functionality an easy task. Build automation software, mind mapping tools, organisation charts, or simple programming platforms in minutes by implementing the library into your project.
Stars: ✭ 107 (+296.3%)
Mutual labels:  chart, diagram, flowchart
Swiftcharts
Easy to use and highly customizable charts library for iOS
Stars: ✭ 2,336 (+8551.85%)
Mutual labels:  chart, charts, graphs
UCharts
UCharts allows creating radar charts, pie charts, half pie chart in your Unity3d Games.
Stars: ✭ 33 (+22.22%)
Mutual labels:  chart, charts
Cedar
JavaScript Charts for ArcGIS
Stars: ✭ 230 (+751.85%)
Mutual labels:  chart, charts
Charts.css
Open source CSS framework for data visualization.
Stars: ✭ 4,595 (+16918.52%)
Mutual labels:  chart, charts
Laue
🖖📈 Modern charts for Vue 2.0
Stars: ✭ 245 (+807.41%)
Mutual labels:  chart, charts
Reaviz
📊 Data visualization library for React based on D3
Stars: ✭ 215 (+696.3%)
Mutual labels:  chart, charts
View All Similar Projects ➔

Mermaid

CI codecov Latest Stable Version Packagist download count

This extension provides the #mermaid parser function to support the generation of diagrams and flowcharts with the help of the mermaid script language. Supported diagram forms include:

  • Flowchart
  • Sequence Diagram
  • Class Diagram
  • State Diagram
  • Gantt Chart
  • Pie Chart
  • Entity Relationship Diagram
  • Git Flow Chart
  • User Journey Chart

Requirements

Requirements for Mermaid 3.x:

  • PHP 7.0 or later
  • MediaWiki 1.33 or later

You can use an older version of Mermaid for older versions of MediaWiki and/or PHP.

Installation and configuration

See the information on installing and configuring this extension.

Usage

See the information on using this extension.

Contribution and support

If you want to contribute work to the project please subscribe to the developers mailing list and have a look at the contribution guideline.

For developers

See the documention on how to update MermaidJS.

Tests

This extension provides unit and integration tests that are run by a continues integration platform but can also be executed using composer phpunit from the extension base directory.

License

GNU General Public License, version 2 or later.

Note that the project description data, including the texts, logos, images, and/or trademarks, for each open source project belongs to its rightful owner. If you wish to add or remove any projects, please contact us at [email protected].